0 items - €0.00 0
  • Empty cart!
igf-1-des1-3

IGF-1 DES

50.00

Category:
Peptide name: IGF-1 DES
Weight / Volume: 1mg
Availability: In stock
Current batch test results: updated 10 Dec, 2017
Certificate of Analysis:  

Product Description

 Amino Acid sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

IGF-1 DES is a research chemical and is intended only for research purposes such as vitro testing and laboratory experimentation.
This chemical product is not for use as food additive, drug, cosmetics, household chemical or other inappropriate applications.
IGF-1 DES is not a medicine and is not intended to diagnose, cure, mitigate, treat or prevent diseases.

IGF-1 DES will be delivered in sterile sealed freeze-dried (lyophilized) powder form, guaranteed to be fresh and pure with nothing removed or added to it.